PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01004816G0090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family SBP
Protein Properties Length: 331aa    MW: 35966.4 Da    PI: 8.7693
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01004816G0090genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.26.3e-4055132178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC ++l +akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  PH01004816G0090  55 RCQVEGCGVELGSAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 132
                      6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-3248117IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.87253130IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-3854135IPR004333Transcription factor, SBP-box
PfamPF031101.4E-3056129IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEWTAPKPTS PSSPPLLWDW GDAAVPDSSG EAAGRRGKEK RAKGEEGGGG GGKVRCQVEG  60
CGVELGSAKE YHRKHRVCEA HTKCPRVVVA GQERRFCQQC SRFHALSEFD QKKRSCRRRL  120
SDHNARRRKP QPDAFSFASA RLPSSLLFDD RQQISFVWNK APISHVRPFA YSPSPWDSPC  180
DFKLPRVKEI REISTKVGTT NGQVHLDKSH LSNALPTLSH DIDELLPMKG SDASLTASKL  240
DGALDLQRAL SLLSASSCGL SDPVQQASCL IQFTGASQNS RDLPLSHGGN SASASCAEGL  300
PIAPPSQLVR FTMDASSNGY ESTLFGVNQI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2549129484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111128KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1010320.0FP101032.1 Phyllostachys edulis cDNA clone: bphyem201p14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-104SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLK3YU030.0K3YU03_SETIT; Uncharacterized protein
STRINGSi017749m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.44e-44squamosa promoter binding protein-like 10